# GLP-2 (Glucagon-Like Peptide-2) Research Profile 2026: GLP2R Biology, Intestinal Adaptation & Teduglutide Evidence
> Research Purposes Only: GLP-2 and its research analogs are studied for their intestinal biology and potential therapeutic applications. This article is for educational and scientific research purposes only and does not constitute medical advice.
---
Introduction
Glucagon-like peptide-2 (GLP-2) is a 33-amino acid intestinal peptide hormone co-secreted with GLP-1 from enteroendocrine L-cells of the distal small intestine and colon. First identified as a proglucagon cleavage product in the early 1980s and demonstrated to have potent intestinotrophic activity in 1996 by Drucker and colleagues, GLP-2 has become a central focus of intestinal adaptation research and gut mucosal biology.
The clinical importance of GLP-2 research is exemplified by teduglutide (Gattex® in the United States, Revestive® in Europe) — a GLP-2 analog engineered for extended half-life that received FDA approval in 2012 for short bowel syndrome (SBS) with intestinal failure. This represents one of the few instances where basic peptide biology research has translated directly into an approved therapy targeting intestinal function.
This research profile examines GLP-2's molecular pharmacology, receptor signaling, intestinotrophic mechanisms, clinical evidence, and the expanding research landscape for intestinal repair and mucosal regeneration.
---
Molecular Biology and Biosynthesis
Proglucagon Processing
GLP-2 is generated by tissue-specific post-translational processing of proglucagon — a 180-amino acid precursor encoded by the GCG gene. The processing is orchestrated by prohormone convertases (PCs):
- •In pancreatic α-cells: PC2 cleaves proglucagon to yield glucagon, with glicentin-related pancreatic peptide (GRPP) and oxyntomodulin as byproducts; GLP-1 and GLP-2 remain as inactive major proglucagon fragment (MPGF).
- •In intestinal L-cells and brainstem neurons: PC1/3 cleaves proglucagon to yield GLP-1 (7-37 or 7-36 amide) and GLP-2 (1-33), along with glicentin and oxyntomodulin.
GLP-2 spans amino acids 126–158 of proglucagon. The mature peptide GLP-2(1-33) has the sequence: HADEGSFDQMNTILDNLAARDFINWLIQTKITD — a structural relative of glucagon and GLP-1 but with highly distinct receptor specificity.
L-Cell Secretion
GLP-2 is co-secreted with GLP-1 from L-cells in response to:
- •Luminal nutrients: Particularly lipids (long-chain fatty acids) and carbohydrates, via GPR119, GPR40, SGLT-1, and other nutrient-sensing receptors on L-cell apical membranes
- •Neural signals: Enteric nervous system (ENS) activation, particularly via GIP-containing vagal pathways
- •Bile acids: Via TGR5 activation on L-cells
The meal-driven secretion pattern of GLP-2 is relevant to its intestinotrophic function: postprandial GLP-2 signaling tells the intestinal crypt-villus axis to upregulate its absorptive capacity in anticipation of continued nutrient flux.
Native GLP-2 Pharmacokinetics
Native GLP-2 has an extremely short plasma half-life of approximately 7 minutes due to rapid cleavage by dipeptidyl peptidase-4 (DPP-4) at the Ala²-Asp³ bond, producing the inactive metabolite GLP-2(3-33). This rapid inactivation limits its therapeutic utility and prompted the development of DPP-4-resistant analogs.
---
GLP-2 Receptor (GLP2R) Biology
Receptor Characteristics
The GLP-2 receptor (GLP2R) is a class B GPCR (secretin receptor family) with high ligand specificity for GLP-2. It shares structural features with the GLP-1 receptor (GLP1R) and glucagon receptor, but exhibits minimal cross-reactivity with these hormones under physiological conditions.
GLP2R expression is notably restricted compared to other incretin receptors:
- •High expression: Subepithelial myofibroblasts of the intestinal lamina propria (primary mediator of intestinotrophic effects), enteric neurons, intestinal epithelial cells (crypt-enriched)
- •Moderate expression: Gastrointestinal smooth muscle, pancreatic islets (β-cells), bone
- •Low/absent: Most peripheral tissues
This restricted distribution is pharmacologically relevant: GLP2R's intestinal specificity means GLP-2 signaling has relatively limited systemic effects compared to GLP-1, whose receptor is distributed across multiple metabolically active tissues.
Signal Transduction
GLP2R couples primarily to Gαs, activating adenylyl cyclase and increasing intracellular cAMP. Downstream effectors include:
1. PKA activation → phosphorylation of CREB and downstream trophic gene programs
2. Src/EGFR transactivation → subepithelial myofibroblasts release insulin-like growth factor-1 (IGF-1), keratinocyte growth factor (KGF/FGF7), and ErbB ligands that act on adjacent epithelial cells
3. PI3K/Akt signaling → anti-apoptotic effects in intestinal epithelial cells
4. Wnt/β-catenin pathway modulation → influence on intestinal stem cell (ISC) behavior in crypts of Lieberkühn
A crucial insight from research is that GLP-2's primary intestinotrophic actions are largely paracrine/indirect — the peptide acts on GLP2R-expressing subepithelial myofibroblasts, which then secrete a bouquet of growth factors that drive epithelial proliferation. Direct epithelial GLP2R expression plays a secondary role.
---
Intestinotrophic Mechanisms: The Crypt-Villus Axis
Intestinal Architecture and Homeostasis
The small intestinal epithelium is among the most rapidly renewed tissues in the body: the entire epithelium is replaced every 3–5 days through continuous proliferation of intestinal stem cells (ISCs) in the crypts of Lieberkühn. ISCs generate transit-amplifying progenitors that differentiate into absorptive enterocytes, goblet cells, Paneth cells, and enteroendocrine cells as they migrate up the villus. Senescent cells at the villus tip are shed into the lumen.
This homeostatic process determines villus height (a key determinant of absorptive surface area) and crypt depth (reflecting proliferative capacity). GLP-2 acts to shift this balance toward enhanced proliferation and reduced apoptosis — increasing villus height, crypt depth, and mucosal surface area.
Key Intestinotrophic Effects
GLP-2 signaling drives multiple coordinated responses in the intestinal mucosa:
Increased Crypt Cell Proliferation: GLP-2 stimulates ISC and transit-amplifying progenitor proliferation via indirect signaling through growth factors (IGF-1, KGF) released from subepithelial myofibroblasts. The result is accelerated crypt output and enhanced villus cellularity.
Reduced Apoptosis: GLP-2 activates Akt-mediated pro-survival signaling in intestinal epithelial cells, reducing programmed cell death in the crypt-villus axis. This effect extends villus cell residence time and increases functional absorptive surface.
Enhanced Nutrient Absorption: Multiple nutrient transport proteins are upregulated by GLP-2, including:
- •Sodium-glucose cotransporter 1 (SGLT-1) — glucose and galactose absorption
- •Peptide transporter 1 (PepT1) — di- and tripeptide absorption
- •Fatty acid binding proteins — lipid absorption capacity
Mucosal Blood Flow: GLP-2 is a potent vasodilator in the intestinal circulation, increasing mesenteric blood flow by 20–40% acutely. This hemodynamic effect enhances nutrient delivery and may contribute to the absorptive improvements seen with GLP-2 administration.
Gut Motility Modulation: GLP-2 inhibits gastric emptying and small intestinal motility (via enteric neural pathways), extending the contact time between luminal contents and absorptive mucosa — effectively increasing "functional" absorption per unit time even before structural adaptations occur.
Barrier Function Enhancement: GLP-2 upregulates tight junction proteins (claudins, occludin, ZO-1), reducing intestinal permeability. This barrier-tightening effect has implications for gut barrier dysfunction research in conditions ranging from SBS to inflammatory bowel disease.
---
Teduglutide: The Clinical Proof of Concept
Design and Pharmacology
Teduglutide ([Gly²]GLP-2) is a GLP-2 analog with a single alanine-to-glycine substitution at position 2 — preventing DPP-4 cleavage. This modification extends the plasma half-life from ~7 minutes to approximately 2 hours, enabling once-daily subcutaneous injection rather than continuous infusion.
Teduglutide retains full GLP2R agonist activity with a potency comparable to native GLP-2, while its extended pharmacokinetics enable sustained receptor engagement throughout the day.
Short Bowel Syndrome: Disease Context
Short bowel syndrome (SBS) results from either surgical resection or functional loss of large segments of small intestine — typically >70% — leaving insufficient absorptive capacity to meet nutritional needs without parenteral support. Common causes include Crohn's disease requiring extensive resection, vascular accidents (superior mesenteric artery thrombosis), radiation enteritis, and congenital anomalies.
SBS-intestinal failure (SBS-IF) — where patients require intravenous parenteral nutrition (PN) — is associated with severe quality-of-life impairment, significant morbidity (infections, metabolic complications, hepatic dysfunction), and substantial healthcare costs. Achieving parenteral nutrition independence is a major therapeutic goal.
Phase III Clinical Evidence for Teduglutide
The pivotal STEPS trial (Study of Teduglutide Effectiveness in Parenteral Nutrition Support) demonstrated:
- •Primary endpoint: 63% of teduglutide-treated SBS-IF patients achieved ≥20% reduction in parenteral nutrition/intravenous fluid volume at 24 weeks, versus 30% in the placebo group (p = 0.002).
- •PN independence: A subset of patients on teduglutide achieved complete PN withdrawal — a landmark outcome that had previously been considered unattainable for many SBS-IF patients on stable long-term PN.
- •Structural adaptation: Mucosal biopsies from teduglutide-treated patients showed increased villus height and crypt depth, confirming intestinal adaptation as the mechanism of benefit.
- •Safety: Adverse events were primarily gastrointestinal (abdominal pain, nausea, stoma complications). Given GLP-2's proliferative effects, regulatory monitoring for polyps and colorectal neoplasia was required.
Post-Approval Long-Term Data
Long-term extension studies (up to 30 months) have confirmed sustained benefit with teduglutide, with continued reduction in PN requirements in responders. Importantly, some patients maintained reduced PN needs even during treatment interruptions — suggesting durable intestinal structural adaptation beyond the period of GLP2R stimulation.
---
Research Applications Beyond Short Bowel Syndrome
Inflammatory Bowel Disease
GLP-2's mucosal healing properties have generated interest in inflammatory bowel disease (IBD):
- •Crohn's Disease: GLP-2's anti-inflammatory signaling (reduced TNF-α, IL-1β in intestinal models) and mucosal barrier enhancement are mechanistically relevant. Small studies have suggested GLP-2 or teduglutide may reduce intestinal permeability in Crohn's patients.
- •Ulcerative Colitis: GLP-2's effects on colonocyte proliferation and barrier function are relevant to UC mucosal healing. Research in animal models of DSS-induced colitis has shown protective effects.
Necrotizing Enterocolitis (NEC)
NEC — a devastating intestinal emergency of prematurity — involves pathological intestinal inflammation and necrosis. GLP-2 promotes intestinal proliferation, reduces apoptosis, and enhances barrier function through mechanisms directly relevant to NEC pathogenesis. Neonatal animal studies have shown GLP-2 treatment reduces NEC severity and improves survival — generating interest in human trials for extremely premature infants.
Gut Microbiome Interactions
Emerging research suggests GLP-2 signaling modulates intestinal microbial ecology through:
- •Changes in mucosal architecture (altered niche structure for colonizing bacteria)
- •Antimicrobial peptide expression (Paneth cell defensins are GLP-2 regulated in some models)
- •Altered mucus layer composition
Whether microbiome shifts observed with teduglutide in SBS patients are mechanistically meaningful or secondary to changes in intestinal structure and function remains an active research question.
Bone Metabolism
GLP2R expression in osteoblasts and osteoclasts has prompted research into GLP-2's role in bone remodeling. Acute GLP-2 administration reduces bone resorption markers in humans — a GLP2R-mediated effect that may have implications for the elevated fracture risk seen in IBD and SBS patients.
---
GLP-2 Research Compounds and Analogs
Beyond teduglutide, several GLP-2 analogs are under investigation:
| Compound | Modification | Development Stage |
|---|---|---|
| Teduglutide | [Gly²] substitution; DPP-4 resistant | FDA/EMA approved (SBS-IF) |
| APGLP-2 | Albumin-binding fatty acid chain; extended half-life (~5 days) | Preclinical |
| Long-acting GLP-2 fusions | GLP-2-albumin or GLP-2-Fc fusions | Research phase |
The search for longer-acting GLP-2 analogs (enabling weekly rather than daily dosing) continues, motivated by the inconvenience of daily subcutaneous injection and the need for improved adherence in chronic SBS management.
---
GLP-2 vs. GLP-1: Key Distinctions
| Feature | GLP-1 | GLP-2 |
|---|---|---|
| Receptor | GLP-1R | GLP2R |
| Receptor distribution | Widespread (pancreas, CNS, heart, gut, kidney) | Predominantly intestinal (myofibroblasts, enteric neurons) |
| Insulin secretion | Yes (incretin effect) | Minimal |
| Glucagon suppression | Yes | No significant effect |
| Intestinotrophic | Minimal | Primary action |
| Satiety/weight loss | Yes (CNS) | Modest at best |
| Gastric emptying inhibition | Yes | Yes (different mechanism) |
| Approved drugs | Semaglutide, liraglutide, exenatide, tirzepatide | Teduglutide |
The GLP-1/GLP-2 system represents an elegant bifurcated postprandial response: GLP-1 handles glycemic control and satiety signaling to match meal intake to metabolic needs, while GLP-2 maintains and adapts the intestinal absorptive infrastructure to efficiently extract the nutrients being consumed.
---
Open Research Questions
1. Optimal dosing for non-SBS applications: The 0.05 mg/kg/day teduglutide dose established for SBS may not be optimal for IBD or other indications with different tissue-level GLP2R requirements.
2. Neoplasia risk: GLP-2's proliferative intestinal effects require long-term surveillance for colorectal polyps and neoplasia — a monitoring requirement built into teduglutide's approval but not yet formally resolved for lifetime risk.
3. GLP-1/GLP-2 co-agonism: Given the complementary actions of GLP-1 and GLP-2, combination or co-agonist approaches might benefit specific patient populations (e.g., bariatric surgery patients with dumping syndrome and SBS features).
4. Biomarkers of response: Identifying which SBS patients will respond to teduglutide with PN independence versus partial reduction would dramatically improve patient selection and resource allocation.
5. Pediatric SBS: The pathophysiology of pediatric SBS (often congenital) differs from adult SBS (typically acquired resection), and GLP-2's effects on the developing intestine require dedicated research.
---
Conclusion
GLP-2 (glucagon-like peptide-2) stands as one of the best-validated intestinotrophic hormones in mammalian biology, with a clear mechanistic understanding extending from receptor-level signaling through crypt-villus axis effects to clinical outcomes in SBS-intestinal failure. The translational success of teduglutide validates GLP-2 biology as a tractable target for intestinal adaptation medicine.
Research frontiers extend from IBD and neonatal NEC to bone metabolism and microbiome interactions, suggesting GLP-2's biology will continue to generate clinically meaningful insights well beyond its established SBS indication.
---
References
1. Drucker DJ, Erlich P, Asa SL, Brubaker PL. Induction of intestinal epithelial growth by glucagon-like peptide 2. Proc Natl Acad Sci USA. 1996;93(15):7911–7916.
2. Jeppesen PB, Hartmann B, Thulesen J, et al. Glucagon-like peptide 2 improves nutrient absorption and nutritional status in short-bowel patients with no colon. Gastroenterology. 2001;120(4):806–815.
3. Jeppesen PB, Gilroy R, Pertkiewicz M, et al. Randomised placebo-controlled trial of teduglutide in reducing parenteral nutrition and/or intravenous fluid requirements in patients with short bowel syndrome. Gut. 2011;60(7):902–914.
4. Drucker DJ, Yusta B. Physiology and pharmacology of the enteroendocrine hormone glucagon-like peptide-2. Annu Rev Physiol. 2014;76:561–583.
5. Benjamin MA, McKay DM, Yang PC, et al. Glucagon-like peptide-2 enhances intestinal epithelial barrier function of both transcellular and paracellular pathways in the mouse. Gut. 2000;47(1):112–119.
6. Burness CB, McCormack PL. Teduglutide: a review of its use in the treatment of patients with short bowel syndrome. Drugs. 2013;73(9):935–947.
---
For research purposes only. This content is educational and does not constitute medical advice. All research involving GLP-2 peptides should be conducted in compliance with applicable institutional and regulatory requirements.
---
Research References
GLP-2 research literature demonstrates its therapeutic mechanisms:
- •PMID 42642903: Recent comprehensive review of GLP-2 pharmacology and therapeutic potential.
- •PMID 42601876: GLP-2 receptor signaling in intestinal barrier function and nutrient absorption.
- •PMID 42591359: Clinical applications of glucagon-like peptide-2 in gastrointestinal health.