LL-37

LL-37 is a 37-amino-acid cationic host defense peptide (HDP) and the only member of the cathelicidin family expressed in humans. Derived from the C-terminal cleavage of the precursor protein hCAP18 (human cathelicidin antimicrobial protein of 18 kDa), LL-37 is produced by epithelial cells, neutrophils, mast cells, natural killer cells, monocytes, and macrophages. The designation "LL-37" reflects the peptide's two N-terminal leucine residues and its total length of 37 amino acids.

Mechanism of Action

LL-37 exerts its biological effects through multiple, often concurrent pathways:

**Membrane Disruption:** Like most antimicrobial peptides, LL-37 adopts an amphipathic alpha-helical conformation in lipid environments. This structure allows it to insert into microbial membranes, disrupting lipid bilayer integrity and causing osmotic lysis. The peptide selectively targets negatively charged bacterial membranes while exhibiting considerably lower affinity for the zwitterionic (neutral) membranes of mammalian cells — though at high concentrations cytotoxic effects can occur.

**TLR Modulation:** LL-37 binds directly to Toll-Like Receptors (TLRs), particularly TLR4. Depending on context, it can either suppress or enhance TLR-mediated innate immune signaling. In scenarios of sepsis or endotoxemia, LL-37's neutralization of lipopolysaccharide (LPS) can attenuate excessive TLR4 activation and the associated cytokine storm.

**Receptor-Mediated Signaling:** LL-37 activates several cell surface receptors including FPRL1 (formyl peptide receptor-like 1/FPR2), purinergic receptors (P2X7), and epidermal growth factor receptor (EGFR). Activation of these receptors triggers downstream signaling cascades — particularly MAPK and PI3K/Akt pathways — that regulate inflammation, cell migration, and proliferation.

**Nucleic Acid Interactions:** LL-37 binds extracellular RNA and DNA, forming complexes that can activate endosomal TLRs (TLR7, TLR8, TLR9) in plasmacytoid dendritic cells. This property plays a central role in the autoimmune pathology of psoriasis, where LL-37-DNA complexes drive aberrant type I interferon production.

**Chemotaxis and Immune Cell Recruitment:** LL-37 acts as a chemoattractant for neutrophils, monocytes, mast cells, and T cells, facilitating coordinated cellular recruitment to sites of infection or injury.

Research Applications

### Wound Healing and Tissue Repair Preclinical studies in murine models of cutaneous wounds demonstrate that topically applied or intradermally injected LL-37 accelerates wound closure. Research published in the *Journal of Investigative Dermatology* and related journals has shown LL-37 promotes keratinocyte migration and proliferation via EGFR transactivation, stimulates angiogenesis by upregulating VEGF expression, and induces fibroblast chemotaxis and activation — all relevant to organized repair. Chronic wounds in diabetic models express markedly reduced LL-37, suggesting a mechanistic link between LL-37 deficiency and impaired healing.

### Antimicrobial Properties LL-37 demonstrates broad-spectrum antimicrobial activity in vitro against: - Gram-negative bacteria: *Escherichia coli*, *Pseudomonas aeruginosa*, *Klebsiella pneumoniae*, *Salmonella* spp. - Gram-positive bacteria: *Staphylococcus aureus* (including MRSA), *Streptococcus pyogenes*, *Enterococcus* spp. - Fungi: *Candida albicans* - Enveloped viruses: herpes simplex virus, influenza A, respiratory syncytial virus

Importantly, LL-37's membrane-targeting mechanism creates high barriers to conventional resistance development — organisms cannot readily evolve resistance by altering a single receptor or enzyme, as they can with antibiotics that target specific biochemical pathways.

### Immunomodulation LL-37's immunomodulatory profile is context-dependent and complex. In acute infection, it boosts innate defenses and bridges the transition to adaptive immunity. In chronic inflammatory settings, it may dampen excessive TLR responses. Research in sepsis models shows that LL-37 administration reduces mortality by neutralizing circulating LPS and modulating macrophage cytokine output. Conversely, dysregulated LL-37 expression contributes to autoimmune conditions (psoriasis, lupus) and inflammatory skin diseases.

### Biofilm Disruption Biofilm-associated infections represent one of the most challenging problems in clinical microbiology. LL-37 research has demonstrated efficacy against established biofilms of *Pseudomonas aeruginosa*, *Staphylococcus epidermidis*, and *Staphylococcus aureus* at concentrations that are sublethal for planktonic bacteria. The peptide disrupts biofilm architecture and increases bacterial susceptibility to conventional antibiotics — a potential avenue for combination therapy research.

### Cancer Biology Multiple research groups have investigated LL-37 expression across different tumor types with divergent results. In ovarian cancer, endometrial cancer, and some lung cancers, LL-37 appears to promote tumor cell proliferation and survival through EGFR and Akt signaling — a pro-tumorigenic role. In contrast, LL-37 demonstrates direct cytotoxic effects on gastric cancer cells, colon cancer cells, and leukemia cell lines. These context-dependent effects reflect the broader complexity of cathelicidin biology and highlight the importance of tumor microenvironment in interpreting in vitro data.

Structural Properties

- **Sequence:** [LL-37, 37 aa] - **Molecular Formula:** C₂₀₅H₃₄₀N₆₀O₅₃S (approximate) - **Molecular Weight:** ~4,493 Da - **Secondary Structure:** Random coil in aqueous solution; amphipathic alpha-helix in membrane-mimetic or lipid environments - **Net Charge:** +6 at physiological pH (cationic) - **Hydrophobic Moment:** High — facilitates membrane partitioning

The amphipathic helix adopts a characteristic curved structure with a distinct hydrophobic face (residues Phe6, Ile13, Ile17, Val21, Leu28, Leu31) and a hydrophilic face carrying the positive charges that interact with negatively charged bacterial surfaces.

Expression and Regulation

LL-37 expression is regulated by several factors:

**Vitamin D:** Calcitriol (1,25-dihydroxyvitamin D3) strongly induces cathelicidin gene expression in macrophages and epithelial cells via a vitamin D response element in the CAMP gene promoter. This has led to considerable research interest in vitamin D's role in antimicrobial host defense and susceptibility to tuberculosis and other infections.

**Bacterial Products:** LPS, peptidoglycan, and other pathogen-associated molecular patterns upregulate LL-37 expression through NF-κB-dependent and -independent pathways.

**Butyrate and Short-Chain Fatty Acids:** Microbial metabolites in the gut induce cathelicidin expression in colonocytes, linking microbiome composition to mucosal antimicrobial defense.

**Inflammatory Cytokines:** IL-1β, TNF-α, and IFN-γ modulate LL-37 expression, integrating its production into the broader inflammatory response network.

Research Formulations

LL-37 for research use is typically available as lyophilized (freeze-dried) powder in 10 mg vials. Standard specifications include: - **Purity:** ≥95–99% by HPLC - **Form:** Lyophilized powder - **Reconstitution:** Sterile water or acetic acid (0.1%) is commonly used; the peptide is water-soluble but can aggregate at high concentrations - **Storage:** Lyophilized: -20°C for long-term storage; avoid repeated freeze-thaw cycles after reconstitution - **Certificate of Analysis (COA):** Typically includes HPLC chromatogram, mass spectrometry confirmation, and purity percentage

Reconstituted solutions should be prepared fresh or aliquoted and stored at -80°C to minimize degradation.

Important Research Considerations

**Proteolytic Susceptibility:** LL-37 is rapidly degraded in biological fluids by proteases including elastase, cathepsin D, and staphylococcal proteases. This limits its stability in complex biological matrices and is an active area of research for developing protease-resistant analogs.

**Concentration-Dependent Effects:** LL-37's effects are highly concentration-dependent. At physiological concentrations (~1–2 μM at mucosal surfaces), it functions primarily as an immunomodulator. At higher concentrations, direct antimicrobial and cytotoxic effects predominate. In vitro experiments must carefully control for this dose-dependency.

**Species Differences:** LL-37 is human-specific. The murine equivalent is CRAMP (cathelin-related antimicrobial peptide), which shares structural and functional properties but differs in sequence. Results from murine models cannot be directly extrapolated to human LL-37 pharmacology.

Regulatory and Ethical Context

LL-37 is sold strictly for in vitro laboratory research and preclinical animal studies. It is not approved for human therapeutic use by the FDA or any other regulatory agency. All research applications must comply with applicable institutional review board (IRB) protocols and relevant animal welfare regulations. This product is for research use only (RUO).