> Research Use Only Disclaimer: LL-37 is a research peptide not approved by the FDA for therapeutic use in humans. All dosing information, protocols, and data presented in this article are sourced from peer-reviewed scientific literature and are provided strictly for educational and research purposes. This article does not constitute medical advice. Do not administer LL-37 or any research peptide to humans outside of an approved clinical research protocol.
LL-37 is the only member of the cathelicidin family expressed in humans — a multifunctional host defense peptide that bridges innate antimicrobial activity with adaptive immune regulation. With 58+ suppliers carrying LL-37 in their catalogs, it ranks among the most widely sourced research peptides on the market. Yet standardized reconstitution and dosage protocols for in vitro and in vivo research remain scattered across the literature.
This guide consolidates published reconstitution procedures, solubility data, and dose ranges from peer-reviewed studies to support researchers working with human cathelicidin LL-37.
---
What Is LL-37? Cathelicidin Host Defense Overview
LL-37 (also designated hCAP-18/LL-37 or CAMP gene product) is a 37-amino acid α-helical antimicrobial peptide derived from the C-terminal domain of the human cathelicidin precursor protein hCAP-18. Its name reflects its structure: two N-terminal leucines followed by 35 additional residues, forming the amphipathic α-helix that drives membrane-disrupting activity.
Key biological properties:
- •Molecular weight: 4,493 Da
- •Sequence: [LL-37, 37 aa]
- •Secondary structure: Random coil at low ionic strength → α-helical in hydrophobic environments
- •Net charge: +6 at physiological pH (strongly cationic)
LL-37 is produced primarily by neutrophils, epithelial cells, monocytes, and NK cells in response to infection, inflammation, and injury. It serves as a first-line antimicrobial barrier while simultaneously modulating cytokine signaling, wound healing, and angiogenesis — making it a uniquely versatile research target.
Dual Mechanism: Antimicrobial + Immunomodulatory
Antimicrobial activity operates through membrane disruption: the cationic helix electrostatically binds anionic bacterial membranes, inserts into the lipid bilayer, and disrupts membrane integrity via toroidal pore or carpet model mechanisms. Active against gram-positive bacteria, gram-negative bacteria, fungi, and enveloped viruses at MIC values typically in the 1–16 µg/mL range.
Immunomodulatory activity operates through receptor-mediated signaling:
- •Binds formyl peptide receptor-like 1 (FPRL1/FPR2) → chemotaxis, immune cell activation
- •Activates P2X7 receptor → inflammasome activation, IL-1β processing
- •Modulates TLR signaling → dose-dependent pro- or anti-inflammatory effects
- •Stimulates keratinocyte migration, proliferation, and VEGF expression → wound healing
---
Research Forms and Preparations
Lyophilized Powder Specifications
LL-37 for research is supplied as lyophilized white powder at the following standard purities:
| Specification | Research Grade | High-Purity Grade |
|---|---|---|
| Purity | ≥95% (HPLC) | ≥98% (HPLC) |
| Endotoxin | <5 EU/mg | <1 EU/mg |
| Molecular weight | 4,493 Da (confirmed by MS) | 4,493 Da (confirmed by MS) |
| Counter-ion | Acetate (TFA-free preferred) | Acetate (TFA-free) |
| Appearance | White to off-white powder | White powder |
TFA (trifluoroacetate) note: Many synthetic peptides are purified using TFA-based HPLC gradients, leaving TFA as a counter-ion in the final product. TFA is cytotoxic at higher concentrations and can confound antimicrobial and cell viability assays. For cell culture work, specify TFA-free or acetate salt LL-37 from suppliers who perform counter-ion exchange.
Endotoxin testing is critical for LL-37 given its immunomodulatory activity. Lipopolysaccharide (LPS) contamination can mimic or amplify LL-37's pro-inflammatory effects in cell assays. Confirm endotoxin specification (<1 EU/mg for cell work) before ordering.
---
Reconstitution Protocol
Recommended Solvent: 0.1% Acetic Acid
LL-37's amphipathic helix and cationic charge make it prone to aggregation in neutral aqueous solutions. The standard reconstitution solvent reported across published studies is 0.1% acetic acid (sterile, endotoxin-free), which protonates surface residues and prevents self-association.
Alternative solvents:
- •Bacteriostatic water (0.9% benzyl alcohol): acceptable for subcutaneous research models; benzyl alcohol provides preservation but can interfere with antimicrobial assays
- •PBS (pH 7.4): usable but carries higher aggregation risk; mix immediately before use
- •DMSO (small volume, then dilute): a secondary option for hydrophobic assay conditions
Avoid:
- •Plain sterile water at neutral pH (aggregation risk)
- •High-salt buffers during initial dissolution (ionic screening reduces solubility)
Step-by-Step Reconstitution
| Step | Action | Notes |
|---|---|---|
| 1 | Allow vial to equilibrate to room temperature | Prevents condensation from entering vial |
| 2 | Add 0.1% acetic acid to achieve 1 mg/mL stock | Standard stock concentration |
| 3 | Gently swirl; do NOT vortex | Vortexing promotes aggregation |
| 4 | Allow 5–10 minutes for complete dissolution | Solution should be clear to slightly opalescent |
| 5 | Aliquot into single-use volumes | Prevent repeated freeze-thaw |
| 6 | Flash-freeze aliquots in liquid nitrogen or dry ice | Preserves helical structure |
Concentration Reference Table
| LL-37 Powder | Solvent Volume | Resulting Concentration |
|---|---|---|
| 1 mg | 1 mL 0.1% acetic acid | 1,000 µg/mL (1 mg/mL) |
| 1 mg | 2 mL 0.1% acetic acid | 500 µg/mL |
| 5 mg | 5 mL 0.1% acetic acid | 1,000 µg/mL |
| 1 mg | 0.5 mL 0.1% acetic acid | 2,000 µg/mL (2 mg/mL) — high-stock |
Working dilutions: Dilute stock with sterile PBS or cell culture media immediately before use. Avoid extended incubation of diluted LL-37 at room temperature.
---
Research Dosing Ranges: What the Literature Reports
LL-37 research spans three principal application areas — in vitro antimicrobial testing, wound healing models, and in vivo immunomodulatory studies — each with distinct dose ranges.
In Vitro Antimicrobial Studies
The minimum inhibitory concentration (MIC) and minimum bactericidal concentration (MBC) vary by organism:
| Target Organism | MIC Range (Literature) | Reference Conditions |
|---|---|---|
| S. aureus (MRSA) | 2–16 µg/mL | 37°C, MHB, log phase |
| E. coli | 1–4 µg/mL | 37°C, MHB, log phase |
| P. aeruginosa | 4–32 µg/mL | Higher MIC due to LPS structure |
| C. albicans | 4–8 µg/mL | Anti-fungal activity confirmed |
| Enveloped viruses (HSV-1) | 0.5–2 µg/mL | Membrane disruption mechanism |
Important assay note: Standard MHB (Mueller-Hinton Broth) contains divalent cations (Mg²⁺, Ca²⁺) that can reduce LL-37 activity by up to 8-fold versus low-salt conditions. Ion-adjusted media or defined minimal media more accurately reflect physiological salt conditions. Salt concentration should be specified in all published protocols.
Wound Healing and Keratinocyte Research
Published in vitro and animal model data for wound healing applications:
| Application | Dose / Concentration | Model | Key Finding |
|---|---|---|---|
| Keratinocyte migration | 0.1–1 µg/mL | HaCaT scratch assay | Enhanced migration at 1 µg/mL (Koczulla et al., 2003) |
| Keratinocyte proliferation | 1–5 µg/mL | Primary keratinocytes | EGFR-dependent proliferation (Heilborn et al., 2003) |
| Angiogenesis (VEGF induction) | 1–10 µg/mL | HUVECs | Significant VEGF-A upregulation at 5 µg/mL |
| Murine wound healing (topical) | 10–50 µg per application | Full-thickness excisional wound | Accelerated re-epithelialization (Ramos et al., 2011) |
| Murine wound healing (injected) | 1–5 µg per wound site | Intradermal, single injection | Improved wound closure at day 7 |
In Vivo Immunomodulatory Research (Rodent Models)
For systemic or site-specific immune modulation research in preclinical models:
| Route | Dose Range | Notes from Literature |
|---|---|---|
| Intradermal | 1–10 µg per injection site | Chemotaxis, DC recruitment |
| Subcutaneous | 5–25 µg per injection | Systemic immune activation; dose-dependent cytokine release |
| Intraperitoneal | 0.5–5 mg/kg | Sepsis protection models; timing relative to challenge critical |
| Topical (wound/skin) | 10–100 µg/cm² | Antimicrobial + wound healing applications |
| Intranasal | 10–50 µg total dose | Respiratory infection models |
Murine sepsis models: Several studies have investigated LL-37 in LPS-induced sepsis. Weber et al. (2009) reported reduced mortality with 2.5 mg/kg LL-37 administered 30 minutes post-LPS challenge in mice. The protective window is narrow — timing relative to the inflammatory stimulus is critical in these models.
---
Administration Route Considerations
Topical Application (Wound Research)
Topical delivery is the most studied route for LL-37 wound healing research. Key considerations:
- •Vehicle selection: Hydrogel carriers (methylcellulose, carboxymethylcellulose) stabilize LL-37 at the wound surface better than aqueous solutions alone. Collagen matrices have been used in published wound healing studies.
- •Concentration: 10–100 µg/cm² covers the published range; 25–50 µg/cm² is most commonly reported for excisional wound models.
- •Frequency: Once- or twice-daily application. LL-37's stability at wound pH (~7.4) supports daily dosing without significant degradation over 24-hour intervals.
- •Protease susceptibility: Wound fluid proteases (MMP-2, elastase, plasmin) cleave LL-37, reducing local concentrations. Studies assessing sustained efficacy typically use matrix-embedded or protease-stabilized formulations.
Subcutaneous / Intradermal Research
For systemic or site-specific immune studies:
- •Injection volume: 50–200 µL per site (rodent subcutaneous)
- •Solvent pH: Reconstituted LL-37 in 0.1% acetic acid (pH ~3.5) should be pH-adjusted to 6.0–7.0 before subcutaneous injection to minimize injection-site irritation
- •Adjuvant activity: At 5–25 µg doses in murine models, LL-37 acts as an endogenous adjuvant — recruiting dendritic cells and enhancing antigen presentation. This property is exploited in vaccine research models.
Local Injection (Site-Specific)
For localized infection or wound models requiring site-specific delivery:
- •Intradermal injections of 1–10 µg in 10–50 µL are well-tolerated in rodent models
- •Higher local concentrations (>50 µg/mL) can trigger mast cell degranulation — relevant to allergy and inflammation research models
---
Wound Healing and Immunomodulatory Research Applications
Wound Healing
LL-37's role in wound repair spans three phases:
1. Hemostasis / Antimicrobial phase: LL-37 in platelet granules is released at the wound site, providing immediate antimicrobial activity and preventing biofilm formation. Platelet LL-37 concentrations at wounds reach 2–5 µg/mL locally (Krauss et al., 2012).
2. Proliferative phase: Via EGFR transactivation and direct FPR2 receptor signaling, LL-37 stimulates keratinocyte and fibroblast proliferation. VEGF-A upregulation promotes neovascularization. Animal model studies consistently demonstrate accelerated re-epithelialization with exogenous LL-37 application (Ramos et al., 2011; Heilborn et al., 2003).
3. Remodeling phase: Anti-inflammatory activity at higher local concentrations limits excessive scarring. LL-37's ability to neutralize LPS and other PAMPs at the wound site suppresses chronic inflammatory signaling that impairs healing.
Chronic wound research: Diabetic wounds show deficient LL-37 levels relative to acute wounds. Multiple research groups have investigated exogenous LL-37 supplementation in diabetic rodent wound models, with consistent findings of improved closure rates and reduced bacterial burden.
Immunomodulatory Research Applications
| Application | Mechanism | Key Evidence |
|---|---|---|
| Anti-biofilm | Disrupts biofilm architecture; suppresses P. aeruginosa and MRSA biofilm formation | Overhage et al., 2008 |
| Neutrophil chemotaxis | FPR2-mediated recruitment to infection sites | De Yang et al., 2000 |
| Dendritic cell activation | TLR9 signaling modulation; innate-adaptive bridge | Choi et al., 2012 |
| Sepsis protection | LPS neutralization; reduced systemic cytokine storm | Weber et al., 2009 |
| Antiviral activity | Membrane disruption; antiviral signaling induction | Currie et al., 2016 |
| Anti-cancer (in vitro) | Dose-dependent cytotoxicity in some tumor cell lines | Mader et al., 2009 |
Note on dose-dependent immunology: LL-37 exhibits biphasic immunomodulatory behavior. At lower concentrations (~0.5–2 µg/mL), it is predominantly pro-inflammatory (chemotaxis, cytokine induction). At higher concentrations (~10–25 µg/mL) or under specific ionic conditions, anti-inflammatory effects dominate. Research designs must account for this dose-dependent behavior when interpreting cytokine data.
---
Stability and Storage Data
Lyophilized Powder
| Condition | Shelf Life |
|---|---|
| -20°C (sealed, desiccated) | 24+ months |
| 4°C (sealed, desiccated) | 6–12 months |
| Room temperature | Not recommended (>1 month) |
Reconstituted Solution
| Condition | Stability |
|---|---|
| -80°C (single-use aliquots) | 6–12 months |
| -20°C (single-use aliquots) | 3–6 months |
| 4°C | 1–2 weeks (use promptly) |
| Room temperature | 24–48 hours maximum |
Freeze-thaw cycles: Limit to ≤3 total. Each freeze-thaw cycle promotes aggregation and reduces monomeric peptide concentration. Aliquot stocks to avoid repeated cycling.
Aggregation monitoring: If reconstituted LL-37 appears turbid or forms visible precipitate, it has aggregated and antimicrobial/cell assay performance will be reduced. Diluting into warm buffer (37°C) and gentle sonication (bath sonicator, 30 seconds) can partially disaggregate the peptide.
Light sensitivity: LL-37 does not contain photosensitive residues but should be stored away from direct UV exposure as a general peptide handling practice.
pH and Temperature Stability
LL-37 maintains structural integrity across pH 4.0–8.0. Below pH 3.0 (strongly acidic) or above pH 9.0 (strongly basic), denaturation accelerates. Working solutions in physiological buffers (pH 7.0–7.4) are appropriate for most cell and animal assays.
---
Quick Reference: LL-37 Research Protocol Summary
| Parameter | Specification |
|---|---|
| Reconstitution solvent | 0.1% acetic acid (sterile, endotoxin-free) |
| Stock concentration | 1–2 mg/mL |
| In vitro antimicrobial dose | 1–32 µg/mL (organism-dependent) |
| Wound healing (topical) | 10–100 µg/cm² |
| Wound healing (injectable, rodent) | 1–5 µg per site (intradermal) |
| Immunomodulatory (subcutaneous, rodent) | 5–25 µg per injection |
| Sepsis models (IP) | 0.5–5 mg/kg |
| Storage (lyophilized) | -20°C, desiccated, up to 24 months |
| Storage (reconstituted) | -80°C aliquots, ≤3 freeze-thaw cycles |
| Purity requirement | ≥95% HPLC; TFA-free for cell assays |
| Endotoxin | <1 EU/mg for cell work |
---
Related Resources
- •LL-37: The Human Cathelicidin Antimicrobial Peptide — Research Profile
- •Peptide Reconstitution Calculator
---
> Disclaimer: All information in this article is derived from peer-reviewed scientific literature and is provided for educational and research purposes only. LL-37 is not approved by the FDA or any regulatory authority for therapeutic use in humans. This content does not constitute medical advice, diagnosis, or treatment recommendations. Researchers should follow all applicable institutional guidelines, IRB/IACUC protocols, and local regulations when working with research peptides.