LL-37: The Human Cathelicidin Antimicrobial Peptide in Research

What Is LL-37?

LL-37 is a 37-amino acid cationic antimicrobial peptide — the only known human cathelicidin. It is derived from the C-terminal end of the human cathelicidin precursor protein hCAP18 (human Cationic Antimicrobial Protein 18 kDa) through proteolytic cleavage by serine proteases. LL-37 functions at the intersection of innate immunity, adaptive immunity modulation, and wound healing, making it one of the most multifunctional host defense peptides in the human immune arsenal.

For dosing, reconstitution, and protocol details, see our LL-37 Dosage Protocol Guide — Cathelicidin Antimicrobial Peptide Research (2026).

The name "LL-37" reflects its structure: it begins with two leucine (L) residues and contains 37 amino acids in total. The peptide sequence is [LL-37, 37 aa], which forms an amphipathic alpha-helical structure that is fundamental to its biological activities. This amphipathic helix — with positively charged residues on one face and hydrophobic residues on the other — enables LL-37 to interact with and disrupt bacterial membranes while also engaging mammalian immune receptors.

Structure and Biophysics

Amphipathic Alpha Helix

The defining structural feature of LL-37 is its amphipathic alpha-helical conformation, adopted upon contact with membrane surfaces or in hydrophobic environments. In aqueous solution, LL-37 is relatively disordered, but in membrane-mimicking environments (bacterial membranes, lipid bilayers, trifluoroethanol), it adopts a stable alpha-helical conformation from approximately residues 2-31.

Key structural properties:

• •Net charge: +6 (at physiological pH) — critical for electrostatic attraction to negatively charged bacterial membranes
• •Hydrophobic moment: High amphipathicity facilitates membrane penetration and disruption
• •Helix amphipathicity: Segregates positive charges (Lys, Arg) and hydrophobic residues to opposite faces of the helix
• •Flexibility: The C-terminal region (residues 31-37) is less structured, providing flexibility for receptor binding

Self-Association and Concentration-Dependent Behavior

LL-37 exhibits concentration-dependent self-association: at physiological concentrations it forms dimers, while at higher concentrations it forms larger aggregates. This self-association behavior affects its biological activity and complicates dose-response relationships in research models. Micromolar concentrations favor monomeric and dimeric forms with antimicrobial activity, while nanomolar concentrations tend to show more receptor-mediated immunomodulatory effects.

Biosynthesis and Regulation

hCAP18 Precursor Processing

LL-37 is generated from its precursor, hCAP18, through proteolytic cleavage:

1. hCAP18 (18 kDa) is synthesized and stored in neutrophil secondary granules and epithelial cells

2. Upon activation/infection, serine proteases (proteinase 3 in neutrophils, kallikreins in skin) cleave the signal peptide and cathelicidin domain

3. The C-terminal 37 amino acids (LL-37) are released as the active antimicrobial peptide

Expression Regulation

LL-37 expression is regulated by multiple signals:

• •Vitamin D3 (1,25-dihydroxyvitamin D3): A potent inducer of LL-37 expression through vitamin D response elements (VDREs) in the CAMP gene promoter. This provides a direct molecular link between vitamin D status and innate immune capacity.
• •Butyrate: Short-chain fatty acid produced by intestinal microbiota that induces CAMP gene expression in colonocytes and immune cells
• •Infections: Bacterial and viral infections upregulate LL-37 expression through NF-κB and MAPK pathways
• •Cytokines: TNF-α, IL-6, IL-1β, and interferons influence LL-37 expression in various cell types
• •Epigenetic regulation: Histone deacetylase (HDAC) inhibitors upregulate LL-37 through epigenetic derepression of the CAMP gene

Tissue Distribution

LL-37/hCAP18 is expressed in:

• •Neutrophils: Primary storage site (secondary/specific granules)
• •Epithelial cells: Skin, lung, intestine, urogenital tract — expressed constitutively at low levels, strongly induced by infection
• •Macrophages: Induced by microbial stimuli and vitamin D
• •NK cells: Express hCAP18 and release LL-37 upon activation
• •Mast cells: Store pre-formed LL-37 for rapid release
• •Plasma: Low circulating levels, higher in infection/inflammation

Mechanism of Action

Direct Antimicrobial Activity

LL-37 kills bacteria, fungi, and some enveloped viruses through membrane-disrupting mechanisms:

Toroidal Pore Formation: The most established model for LL-37's antimicrobial activity. Amphipathic helices insert into bacterial membranes in a detergent-like fashion, with the positively charged face attracted to the negatively charged lipopolysaccharide (Gram-negative) or teichoic acids (Gram-positive) on bacterial outer membranes. Multiple LL-37 molecules aggregate to form toroidal pores that allow ions and molecules to leak, dissipating membrane potential and causing cell death.

Carpet Mechanism: At higher concentrations, LL-37 may act via a carpet mechanism, coating the membrane surface until its structural integrity collapses.

Intracellular Targeting: Beyond membrane disruption, LL-37 can translocate across bacterial membranes at sub-lethal concentrations to interact with intracellular targets including DNA and ribosomes.

Antimicrobial Spectrum:

• •Gram-positive bacteria: S. aureus, S. epidermidis, S. pyogenes, Enterococcus
• •Gram-negative bacteria: E. coli, P. aeruginosa, H. pylori, Neisseria
• •Fungi: Candida albicans
• •Enveloped viruses: HIV, influenza, respiratory syncytial virus (RSV)
• •Protozoa: Leishmania

Immune Signaling and Receptor Interactions

LL-37 is much more than a bactericidal peptide — it functions as a multi-receptor agonist that bridges innate and adaptive immunity:

FPRL1/FPR2 (Formyl Peptide Receptor 2): LL-37 is a high-affinity ligand for FPR2 on neutrophils, monocytes, and macrophages. FPR2 activation triggers chemotaxis, phagocytic activation, and pro-inflammatory cytokine production. This receptor engagement makes LL-37 an immune cell chemoattractant and activator.

P2X7 Receptor: LL-37 activates the P2X7 purinergic receptor on macrophages, triggering NLRP3 inflammasome assembly and IL-1β/IL-18 secretion. This mechanism links LL-37 to danger-signal response and sterile inflammation.

EGFR (Epidermal Growth Factor Receptor): LL-37 transactivates EGFR in epithelial cells through matrix metalloproteinase (MMP)-dependent shedding of EGFR ligands. EGFR activation promotes epithelial cell proliferation, migration, and wound healing — a key mechanism for LL-37's tissue repair effects.

TLR4 Modulation: LL-37 can suppress excessive LPS-induced TLR4 signaling by binding to LPS and preventing its recognition by MD-2/CD14/TLR4 complexes, providing anti-endotoxin activity and modulating sepsis responses.

CXCR2: LL-37 engages CXCR2 on neutrophils, contributing to its chemotactic activity and neutrophil recruitment to sites of infection.

Immune Modulation Effects

Beyond receptor-mediated signaling, LL-37 broadly modulates immune responses:

Chemotaxis and Immune Cell Recruitment:

• •Attracts neutrophils, monocytes, macrophages, and dendritic cells to infection sites
• •Acts as a chemoattractant for mast cells (FPRL1-mediated)
• •Promotes T-cell recruitment through indirect chemokine induction

Cytokine Modulation:

• •Stimulates pro-inflammatory cytokines (TNF-α, IL-6, IL-8) at low concentrations through FPR2
• •Suppresses excessive LPS-induced TNF-α at higher concentrations (anti-endotoxin effect)
• •Context-dependent effects on IL-1β (promotes inflammasome; suppresses excessive TLR-mediated production)
• •Promotes IL-10 production in some macrophage contexts (anti-inflammatory)

Dendritic Cell Activation:

• •Enhances DC maturation and migration
• •Promotes DC uptake of self-DNA/self-RNA through FPRL1 (potentially relevant to autoimmunity)
• •Facilitates antigen presentation and adaptive immune priming

Mast Cell Degranulation:

• •LL-37 triggers mast cell degranulation through FPRL1 and Mas-related G protein-coupled receptors
• •Releases histamine, prostaglandins, and cytokines — linking LL-37 to allergic-type responses

Wound Healing and Tissue Repair

LL-37 plays a critical role in wound healing through multiple mechanisms:

Epithelial Cell Proliferation and Migration:

Via EGFR transactivation, LL-37 stimulates keratinocyte and epithelial cell proliferation (promoting epithelialization) and migration (closing wound gaps). These effects require active EGFR signaling and can be blocked by EGFR inhibitors in research models.

Angiogenesis Promotion:

LL-37 is a direct pro-angiogenic factor — it stimulates endothelial cell migration, proliferation, and tube formation in in vitro angiogenesis assays. In vivo, LL-37 promotes neovascularization at wound sites through FPRL1-mediated endothelial signaling and VEGF induction.

Fibroblast Activation:

LL-37 stimulates fibroblast migration and production of extracellular matrix components (collagen, fibronectin), contributing to granulation tissue formation in healing wounds.

Biofilm Disruption:

At infected wound sites, LL-37 disrupts bacterial biofilms — structural communities of bacteria that are highly resistant to antibiotics. LL-37's cationic amphipathic structure allows penetration of biofilm matrix and killing of embedded bacteria, making it relevant for research on chronic wound infections.

Research Applications

Antimicrobial Resistance Research

LL-37's membrane-disrupting mechanism of action makes it inherently difficult for bacteria to develop resistance through traditional mutation mechanisms (unlike antibiotics targeting specific proteins). This property has driven significant research interest in:

• •Understanding the molecular basis of natural resistance to LL-37 (phosphatase/protease modification of cell surface charges)
• •Developing LL-37 derivatives or mimetics with enhanced antimicrobial activity
• •Studying LL-37's synergism with conventional antibiotics
• •Investigating LL-37 as a potential template for novel antibiotic development

Research has demonstrated that while bacteria can develop mechanisms to evade LL-37 (particularly through surface charge modification by pathogens like Staphylococcus aureus), these resistance mechanisms come at a significant fitness cost, potentially making LL-37-resistant bacteria less virulent.

Skin Disease Models

LL-37 has emerged as a central player in inflammatory skin conditions:

Rosacea: LL-37 is overexpressed and aberrantly processed in rosacea skin lesions. Abnormal cathelicidin processing generates LL-37 fragments that trigger TRPV4-mediated vascular responses, neurogenic inflammation, and erythema characteristic of rosacea. Research models targeting LL-37 processing are providing insights into rosacea pathogenesis.

Psoriasis: LL-37 forms complexes with self-DNA released from damaged keratinocytes, creating LL-37/DNA complexes that activate plasmacytoid dendritic cells through TLR9 — breaking innate immune tolerance to self-DNA and triggering the interferon cascade driving psoriasis. This mechanism has established LL-37 as a critical link between keratinocyte damage and autoimmune inflammation in psoriasis.

Atopic Dermatitis: Unlike psoriasis (elevated LL-37), atopic dermatitis is characterized by reduced LL-37 expression, correlating with increased susceptibility to staphylococcal infections common in this condition. Research explores whether LL-37 induction (vitamin D supplementation) can restore antimicrobial protection in atopic dermatitis.

Lupus: LL-37/nucleic acid complexes can also activate TLR7/TLR8/TLR9, potentially contributing to lupus pathogenesis through nucleic acid-immune complex formation — an active research area.

Wound Healing Research

LL-37's pro-healing properties make it valuable in wound repair research, including:

• •Chronic wound models (diabetic wounds, pressure ulcers)
• •Development of LL-37-based wound care treatments
• •Study of EGFR activation in epithelial regeneration
• •Angiogenesis and neovascularization mechanisms

Vitamin D — Innate Immunity Connection

The vitamin D → LL-37 induction pathway provides an experimentally tractable model for studying how vitamin D regulates innate immunity. Research using this axis includes:

• •Epidemiological investigations into vitamin D deficiency and infection susceptibility
• •Studies of TB susceptibility in populations with low vitamin D/LL-37
• •Interventional studies using vitamin D to upregulate LL-37 in infections
• •Mechanistic studies of VDRE-mediated CAMP gene regulation

Cancer Research

LL-37 has complex and context-dependent effects in cancer research:

• •Exhibits direct cytotoxicity toward cancer cell lines through membrane disruption
• •Promotes angiogenesis (potentially tumor-supporting in some contexts)
• •Activates anti-tumor immunity through dendritic cell and NK cell stimulation
• •Upregulates tumor suppressor microRNAs in some cancer lines

The dual pro- and anti-tumor activities of LL-37 reflect its pleiotropic immune-regulatory functions and highlight the importance of dose, context, and tumor microenvironment in LL-37 cancer research.

Safety Profile

> ⚠️ Research Use Only Disclaimer: LL-37 is not approved by the FDA for human therapeutic use outside specific investigational frameworks. All information below pertains exclusively to preclinical and clinical research contexts. This content is for educational and scientific reference only.

Natural Occurrence vs. Exogenous Administration

LL-37 is a naturally produced human peptide — encoded by the CAMP gene and expressed in neutrophils, epithelial cells, mast cells, and NK cells — making it distinct from entirely synthetic research compounds. In physiological settings, endogenous LL-37 is present at concentrations of approximately 1–10 µM in inflammatory microenvironments such as gingival crevicular fluid, and far higher concentrations (up to 300 µM) in psoriatic skin lesions.

This dual existence — as both an endogenous regulator and a potential exogenous research compound — means LL-37's safety profile must be understood across a wide concentration range.

Cytotoxicity at Elevated Concentrations

The most well-characterized safety concern with exogenous LL-37 administration is dose-dependent cytotoxicity to mammalian cells:

• •Hemolytic activity: At concentrations ≥ 10 µM, LL-37 disrupts erythrocyte membranes through its amphipathic helix structure, causing hemolysis. This limits systemic applications and has been a primary hurdle for clinical translation.
• •Lymphocyte toxicity: LL-37 induces granzyme B-mediated apoptosis in CD4⁺CD25⁺FoxP3⁺ regulatory T cells (Tregs), potentially modulating immune tolerance at elevated concentrations (PMID: 21389875).
• •Epithelial cytotoxicity: Alveolar epithelial cells exposed to supraphysiological LL-37 concentrations show pro-inflammatory cytokine release (TNFα, IL-1β, IL-8) and impaired barrier function — a consideration in pulmonary research models.

Serum inhibition compounds these concerns: plasma proteins, including α2-macroglobulin and apolipoprotein A-I, significantly reduce LL-37's antimicrobial and cytotoxic effects in vivo, making systemic bioavailability unpredictable at research doses.

Autoimmune and Pro-Inflammatory Risk

LL-37's capacity to complex with nucleic acids and activate pattern recognition receptors is a double-edged mechanism:

Subsequent research confirmed this extends to systemic lupus erythematosus (SLE): LL-37/DNA complexes stimulate pDCs via FcγRII-mediated endocytosis and TLR9 activation, amplifying the interferon signature that characterizes active SLE (PMID: 32743514). In research contexts, this means LL-37 administration — particularly in models with cellular damage or elevated extracellular DNA — carries a theoretical risk of triggering or exacerbating autoimmune-type responses.

Inflammatory Skin Disease Association

In dermatological research, elevated LL-37 is consistently associated with inflammatory conditions rather than homeostasis. In psoriasis, atopic dermatitis, and rosacea, LL-37 serves as both a biomarker of disease activity and a mechanistic driver of keratinocyte-to-immune-cell signaling (PMID: 22577261). Exogenous administration into skin models should account for this pro-inflammatory potential.

Stability and Half-Life Limitations

LL-37 is rapidly degraded by proteases present in biological fluids:

• •Serine proteases (cathepsin G, proteinase 3) cleave LL-37 at multiple sites
• •Metalloproteinases in inflammatory exudates reduce activity within minutes to hours
• •Plasma half-life is estimated at < 60 minutes, requiring administration strategies that account for rapid proteolysis

This instability is one reason research has focused on modified analogs (truncated fragments, cyclized versions, D-amino acid substitutions) that maintain activity while reducing cytotoxicity and improving stability (PMID: 40869425).

Research Safety Considerations

For laboratory research use:

Comparison to Modified Analogs

Because of cytotoxicity concerns at therapeutic concentrations, modified LL-37 analogs — including KR-12 (the minimal antimicrobial domain), GF-17, FK-16, and SAAP-148 — are frequently preferred in research contexts. These fragments retain antimicrobial and immunomodulatory activity with substantially reduced hemolytic activity. Researchers designing LL-37 experiments should evaluate whether a truncated analog provides a more appropriate safety margin for the specific application.

Comparison with Other Antimicrobial Peptides

Research Specifications

• •Molecular weight: 4,493.3 Da
• •Molecular formula: C₂₀₅H₃₄₀N₆₀O₅₃S
• •Sequence: [LL-37, 37 aa]
• •CAS number: 154947-66-7
• •Length: 37 amino acids
• •Net charge: +6 (physiological pH)
• •Available forms: Lyophilized powder, solution
• •Reconstitution: Sterile water or dilute acetic acid (0.1%)
• •Storage: -20°C (lyophilized), 2-8°C (reconstituted)
• •Stability: Stable pH 4-8; avoid proteases in research buffers
• •Classification: For laboratory research use only (RUO)

Related Research Compounds

LL-37 sits within a broader framework of innate immunity peptides:

• •Thymosin Alpha 1 — thymic peptide modulating adaptive immune responses
• •Thymulin — thymic hormone for T-cell differentiation
• •Selank — tuftsin-derived immunomodulator with neuroactive properties
• •BPC-157 — tissue repair peptide with complementary wound-healing research applications

LL-37 remains one of the most studied human host defense peptides, with research spanning antimicrobial biology, immunomodulation, inflammatory disease, and tissue repair.

LL-37 Supplier Pricing Comparison (Live Data — 2026)

LL-37 is a 37-residue cathelicidin peptide available from multiple research suppliers. The following pricing is from the Peptides.SO live listings database, denominated per mg of lyophilized peptide.

Data sourced from Peptides.SO live listings; prices subject to change. LL-37 is a research peptide for in vitro and laboratory use only (RUO).

> Compare all LL-37 offers → peptides.so/peptide/ll-37

---

Frequently Asked Questions

What is the difference between LL-37 and other cathelicidins?

LL-37 is the only cathelicidin found in humans. Other mammals express different cathelicidin family members (e.g., murine CRAMP, bovine BMAP-28, porcine PR-39). All share a conserved N-terminal cathelin domain but diverge in their C-terminal antimicrobial domain. LL-37's human-specific expression makes it the most relevant cathelicidin for human immunology research models.

How does LL-37's antimicrobial activity differ from conventional antibiotics?

Conventional antibiotics typically target specific bacterial proteins or biosynthetic pathways, allowing resistant strains to evolve through point mutations. LL-37 disrupts bacterial membranes through a physical mechanism requiring bacterial membrane remodeling to confer resistance — a much higher fitness cost. Research shows that while bacteria can develop LL-37 resistance (e.g., through surface charge modification), these resistant strains often exhibit reduced virulence. This property makes LL-37 a compelling template for anti-resistance antibiotic research.

What reconstitution conditions work best for LL-37 research?

LL-37 dissolves best in sterile water (for concentrations ≤1 mg/mL) or 0.1% acetic acid (for higher concentrations). The peptide tends to aggregate at physiological pH and high concentrations — this self-association is concentration-dependent and may affect dose-response relationships in cell-based assays. Stock solutions should be stored at -20°C and protected from repeated freeze-thaw cycles.

Why does LL-37 have both pro- and anti-inflammatory effects?

LL-37's effects are highly concentration- and context-dependent. At low nanomolar concentrations, it preferentially activates FPR2 receptor signaling, triggering immune cell chemotaxis and cytokine induction. At higher micromolar concentrations, its membrane-disrupting properties become dominant, with additional LPS-neutralizing effects that dampen excessive inflammatory signaling. The P2X7/NLRP3 inflammasome pathway adds another layer of concentration-dependent regulation. This makes LL-37 an important tool for studying innate immune threshold signaling in research models.

Is LL-37 relevant to vitamin D research?

Yes — the CAMP gene (encoding hCAP18/LL-37) contains vitamin D response elements (VDREs) that are directly activated by 1,25-dihydroxyvitamin D3. This provides a mechanistic link between vitamin D status and innate antimicrobial capacity. Research exploring this axis has examined LL-37 induction in respiratory epithelium (relevant to infection susceptibility) and intestinal epithelium (relevant to gut microbiome homeostasis). LL-37 is frequently used as a biomarker of vitamin D-induced innate immune activation in research studies.

What is the relationship between LL-37 and psoriasis research?

In psoriasis, LL-37 forms complexes with self-DNA released from damaged keratinocytes. These LL-37/DNA complexes activate plasmacytoid dendritic cells (pDCs) via TLR9, initiating an interferon-alpha cascade that drives the pathological immune activation central to psoriasis. This represents a clear case of an innate defense peptide triggering autoimmunity when overproduced in the context of tissue damage. Psoriasis research models frequently measure LL-37 levels and LL-37/DNA complex formation to study this pathway.

Q: What is the relationship between LL-37 and its precursor hCAP-18?

LL-37 is the biologically active C-terminal fragment of human cathelicidin antimicrobial protein 18 (hCAP-18), the only cathelicidin encoded in the human genome. hCAP-18 is stored in granules of neutrophils, monocytes, and NK cells in an inactive pro-peptide form. Upon degranulation, serine protease 3 (PR3) cleaves hCAP-18 at position Ala-134, releasing the 37-amino-acid LL-37 fragment. The N-terminal cathelin domain is retained separately and has its own emerging biology.

Q: How does LL-37 physically disrupt bacterial membranes?

LL-37 adopts an amphipathic α-helical structure in lipid environments. The positively charged face (Lys and Arg residues) electrostatically binds to negatively charged phospholipids preferentially enriched in bacterial membranes (phosphatidylglycerol, cardiolipin), while the hydrophobic face inserts into the bilayer. At higher concentrations this induces a "toroidal pore" or detergent-like membrane disruption (carpet model), causing membrane permeabilization and loss of the proton motive force. The selective toxicity toward bacteria over mammalian cells relies on the anionic character of prokaryotic membranes versus the predominantly zwitterionic outer leaflet of eukaryotic cells.

Q: What role does LL-37 play in innate immune signaling beyond direct antimicrobial action?

LL-37 acts as a damage-associated molecular pattern (DAMP) amplifier and immune recruiter. It binds bacterial LPS and lipoteichoic acid, modulating TLR4 and TLR2 signaling (often in a concentration-dependent biphasic manner — suppressing LPS-TLR4 signaling at low doses, activating it at higher doses). It also signals through purinergic receptors (P2X7), formyl peptide receptors (FPR1/FPRL1), EGFR, and IGF-1R, enabling paracrine communication between epithelial, immune, and stromal cells. This receptor promiscuity underpins its diverse roles in wound healing, inflammation, and cancer biology.

Q: What accounts for LL-37's reported activity against enveloped viruses?

LL-37's mechanism of membrane disruption extends to enveloped viruses, where it can disrupt the viral lipid envelope, block viral binding to host cell receptors (by competing for heparan sulfate binding sites), or suppress viral replication through intracellular immune signaling. Activity has been reported in vitro against influenza, RSV, HIV, SARS-CoV-2, and several herpesviruses, though potency and selectivity vary considerably between viruses and experimental systems.

Q: Why are LL-37 peptide analogs of interest in antibiotic-resistance research?

LL-37 kills bacteria through mechanisms (membrane disruption) that are fundamentally different from the enzyme-active-site inhibition of conventional antibiotics, making co-resistance development less likely. Additionally, LL-37 and its analogs retain activity against many multidrug-resistant (MDR) strains including MRSA and carbapenem-resistant Acinetobacter. Synthetic analogs with improved proteolytic stability, reduced hemolytic activity, and narrowed spectrum are under active development for potential use in wound-care and lung-infection research contexts.

Q: What is the significance of LL-37's role in autoimmune skin conditions from a research perspective?

In psoriasis, keratinocyte-derived LL-37 forms complexes with self-DNA and RNA released from damaged cells. These complexes activate plasmacytoid dendritic cell TLR9 and TLR7 respectively, driving type-I interferon production and the self-sustaining inflammatory loop characteristic of psoriasis. This mechanism — where an antimicrobial peptide becomes a carrier that converts self-nucleic acids into potent immune stimuli — represents a key model for studying the interface between innate antimicrobial defense and autoimmune pathology.

---

Key Research Citations

1. Zanetti M. (2004). Cathelicidins, multifunctional peptides of the innate immunity. J Leukoc Biol, 75(1):39-48. PMID: 12960280

2. Rai M, et al. (2024). LL-37: Structures, Antimicrobial Activity, and Influence on Amyloid-Related Diseases. Biomolecules, 14(3):320. PMID: 38540740

3. Gallo RL, et al. (2019). The Critical Role of the Antimicrobial Peptide LL-37/CRAMP in Protection of Colon Microbiota Balance, Mucosal Homeostasis, Anti-Inflammatory Responses, and Resistance to Carcinogenesis. Crit Rev Immunol, 39(3):191-211. PMID: 31679249

4. Khurshid Z, et al. (2026). LL-37 antimicrobial peptide: Molecular characterisation and its role in oral health and disease — A narrative review. Arch Oral Biol, 172:106200. PMID: 41544412

---

---

Further Reading:

• •Thymosin Alpha 1: Immunomodulatory Peptide for Immune Function Research
• •Selank: Tuftsin Analog for Anxiolytic and Immunomodulatory Research
• •Research Peptide Contamination Risks: How to Identify and Avoid Low-Quality Sources
• •Research Peptide Safety Checklist: 10 Non-Negotiable Steps Before Starting
• •Reconstitution Calculator
• •Dosage Chart